PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G31840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 312aa    MW: 33838.6 Da    PI: 11.6493
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G31840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.71.7e-32139195158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d p+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  OPUNC02G31840.1 139 DGPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKTRKPYLHESRHRHAMKRARGTGGRF 195
                      57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-37137198IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.735138198IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.7E-28141195IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-24141163IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-24172195IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MQTRGAAAEA TPDRSRGGAG AASSSSSSFF ARRRHRGRRR VVAMLLPSSS SSSYASKGDS  60
RRTVDGPMRS TLTFDNNHSV VPSQNIDYGQ PMACISYPYN DSGSGVWTSY SSRSVFHPQI  120
VGGGTSPRVP LPSLEIADDG PIYVNPKQYH GILRRRQLRA KLEAQNKLVK TRKPYLHESR  180
HRHAMKRARG TGGRFLNTKQ LQLQQQSHTT STKTTTDSQN SSGSVHLRLG GGAIGDQTSF  240
PFKAMDSQAN IKRTVASAST FTVTSAAQKD DAFFDRHGHH LSSFSGHFGQ AGAQGGVSSM  300
HNGTQQRVSA MR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-19141200463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179188RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185740.0AK318574.1 Oryza sativa Japonica Group cDNA, clone: J090045B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623433.11e-179PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015623432.11e-179PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLA0A0E0K5V10.0A0A0E0K5V1_ORYPU; Uncharacterized protein
STRINGLOC_Os02g53620.11e-179(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-31nuclear factor Y, subunit A5